Anti BBS12 pAb (ATL-HPA061856)

Catalog No:
ATL-HPA061856-25
$447.00

Description

Product Description

Protein Description: Bardet-Biedl syndrome 12
Gene Name: BBS12
Alternative Gene Name: C4orf24, FLJ35630, FLJ41559
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051444: 74%, ENSRNOG00000007510: 78%
Entrez Gene ID: 166379
Uniprot ID: Q6ZW61
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EFEASTYIQHHLQNATDSGSPSSYILNEYSKLNSRIFNSDISNKLEQIPRVYDVVTPKIEAWRRALDLVLLVLQTDSEIITGHGHTQINSQELTGFL
Gene Sequence EFEASTYIQHHLQNATDSGSPSSYILNEYSKLNSRIFNSDISNKLEQIPRVYDVVTPKIEAWRRALDLVLLVLQTDSEIITGHGHTQINSQELTGFL
Gene ID - Mouse ENSMUSG00000051444
Gene ID - Rat ENSRNOG00000007510
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti BBS12 pAb (ATL-HPA061856)
Datasheet Anti BBS12 pAb (ATL-HPA061856) Datasheet (External Link)
Vendor Page Anti BBS12 pAb (ATL-HPA061856) at Atlas Antibodies

Documents & Links for Anti BBS12 pAb (ATL-HPA061856)
Datasheet Anti BBS12 pAb (ATL-HPA061856) Datasheet (External Link)
Vendor Page Anti BBS12 pAb (ATL-HPA061856)

Product Description

Protein Description: Bardet-Biedl syndrome 12
Gene Name: BBS12
Alternative Gene Name: C4orf24, FLJ35630, FLJ41559
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051444: 74%, ENSRNOG00000007510: 78%
Entrez Gene ID: 166379
Uniprot ID: Q6ZW61
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EFEASTYIQHHLQNATDSGSPSSYILNEYSKLNSRIFNSDISNKLEQIPRVYDVVTPKIEAWRRALDLVLLVLQTDSEIITGHGHTQINSQELTGFL
Gene Sequence EFEASTYIQHHLQNATDSGSPSSYILNEYSKLNSRIFNSDISNKLEQIPRVYDVVTPKIEAWRRALDLVLLVLQTDSEIITGHGHTQINSQELTGFL
Gene ID - Mouse ENSMUSG00000051444
Gene ID - Rat ENSRNOG00000007510
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti BBS12 pAb (ATL-HPA061856)
Datasheet Anti BBS12 pAb (ATL-HPA061856) Datasheet (External Link)
Vendor Page Anti BBS12 pAb (ATL-HPA061856) at Atlas Antibodies

Documents & Links for Anti BBS12 pAb (ATL-HPA061856)
Datasheet Anti BBS12 pAb (ATL-HPA061856) Datasheet (External Link)
Vendor Page Anti BBS12 pAb (ATL-HPA061856)