Description
Product Description
Protein Description: Bardet-Biedl syndrome 12
Gene Name: BBS12
Alternative Gene Name: C4orf24, FLJ35630, FLJ41559
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051444: 74%, ENSRNOG00000007510: 78%
Entrez Gene ID: 166379
Uniprot ID: Q6ZW61
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: BBS12
Alternative Gene Name: C4orf24, FLJ35630, FLJ41559
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051444: 74%, ENSRNOG00000007510: 78%
Entrez Gene ID: 166379
Uniprot ID: Q6ZW61
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | EFEASTYIQHHLQNATDSGSPSSYILNEYSKLNSRIFNSDISNKLEQIPRVYDVVTPKIEAWRRALDLVLLVLQTDSEIITGHGHTQINSQELTGFL |
Gene Sequence | EFEASTYIQHHLQNATDSGSPSSYILNEYSKLNSRIFNSDISNKLEQIPRVYDVVTPKIEAWRRALDLVLLVLQTDSEIITGHGHTQINSQELTGFL |
Gene ID - Mouse | ENSMUSG00000051444 |
Gene ID - Rat | ENSRNOG00000007510 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti BBS12 pAb (ATL-HPA061856) | |
Datasheet | Anti BBS12 pAb (ATL-HPA061856) Datasheet (External Link) |
Vendor Page | Anti BBS12 pAb (ATL-HPA061856) at Atlas Antibodies |
Documents & Links for Anti BBS12 pAb (ATL-HPA061856) | |
Datasheet | Anti BBS12 pAb (ATL-HPA061856) Datasheet (External Link) |
Vendor Page | Anti BBS12 pAb (ATL-HPA061856) |