Protein Description: basic leucine zipper transcription factor, ATF-like
Gene Name: BATF
Alternative Gene Name: B-ATF, BATF1, SFA-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034266: 91%, ENSRNOG00000008588: 91%
Entrez Gene ID: 10538
Uniprot ID: Q16520
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: BATF
Alternative Gene Name: B-ATF, BATF1, SFA-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034266: 91%, ENSRNOG00000008588: 91%
Entrez Gene ID: 10538
Uniprot ID: Q16520
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | TEELKYFTSVLNSHEPLCSVLAASTPSPPEVVYSAHAFHQPHV |
| Documents & Links for Anti BATF pAb (ATL-HPA064962) | |
| Datasheet | Anti BATF pAb (ATL-HPA064962) Datasheet (External Link) |
| Vendor Page | Anti BATF pAb (ATL-HPA064962) at Atlas |
| Documents & Links for Anti BATF pAb (ATL-HPA064962) | |
| Datasheet | Anti BATF pAb (ATL-HPA064962) Datasheet (External Link) |
| Vendor Page | Anti BATF pAb (ATL-HPA064962) |