Description
Product Description
Protein Description: BARX homeobox 2
Gene Name: BARX2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032033: 75%, ENSRNOG00000008592: 68%
Entrez Gene ID: 8538
Uniprot ID: Q9UMQ3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: BARX2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032033: 75%, ENSRNOG00000008592: 68%
Entrez Gene ID: 8538
Uniprot ID: Q9UMQ3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | YPLLSVITRQPTVISHLVPATPGIAQALSCHQVTEAVSAEAPGGEALASSESETEQPTPRQKKPRRSRTIF |
Gene Sequence | YPLLSVITRQPTVISHLVPATPGIAQALSCHQVTEAVSAEAPGGEALASSESETEQPTPRQKKPRRSRTIF |
Gene ID - Mouse | ENSMUSG00000032033 |
Gene ID - Rat | ENSRNOG00000008592 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti BARX2 pAb (ATL-HPA064966 w/enhanced validation) | |
Datasheet | Anti BARX2 pAb (ATL-HPA064966 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti BARX2 pAb (ATL-HPA064966 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti BARX2 pAb (ATL-HPA064966 w/enhanced validation) | |
Datasheet | Anti BARX2 pAb (ATL-HPA064966 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti BARX2 pAb (ATL-HPA064966 w/enhanced validation) |