Protein Description: BAH domain and coiled-coil containing 1
Gene Name: BAHCC1
Alternative Gene Name: BAHD2, KIAA1447
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039741: 82%, ENSRNOG00000043102: 79%
Entrez Gene ID: 57597
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: BAHCC1
Alternative Gene Name: BAHD2, KIAA1447
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039741: 82%, ENSRNOG00000043102: 79%
Entrez Gene ID: 57597
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | SGLDKSGYFELPTSSQDCARPGHQDPLGGKAPQACCTLDKTVGKEAPAGPPGAQKVARIRHQQHLMAAEVEQGGIGAEAKRKSLELA |
| Documents & Links for Anti BAHCC1 pAb (ATL-HPA076910) | |
| Datasheet | Anti BAHCC1 pAb (ATL-HPA076910) Datasheet (External Link) |
| Vendor Page | Anti BAHCC1 pAb (ATL-HPA076910) at Atlas |
| Documents & Links for Anti BAHCC1 pAb (ATL-HPA076910) | |
| Datasheet | Anti BAHCC1 pAb (ATL-HPA076910) Datasheet (External Link) |
| Vendor Page | Anti BAHCC1 pAb (ATL-HPA076910) |