Description
Product Description
Protein Description: BTB and CNC homology 1, basic leucine zipper transcription factor 2
Gene Name: BACH2
Alternative Gene Name: BTBD25
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040270: 85%, ENSRNOG00000006170: 80%
Entrez Gene ID: 60468
Uniprot ID: Q9BYV9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: BACH2
Alternative Gene Name: BTBD25
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040270: 85%, ENSRNOG00000006170: 80%
Entrez Gene ID: 60468
Uniprot ID: Q9BYV9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SNSLKPGLARGQIKSEPPSEENEEESITLCLSGDEPDAKDRAGDVEMDRKQPSPAPTPTAPAGAACLERSRSVASPSCLRSLFSITK |
Gene Sequence | SNSLKPGLARGQIKSEPPSEENEEESITLCLSGDEPDAKDRAGDVEMDRKQPSPAPTPTAPAGAACLERSRSVASPSCLRSLFSITK |
Gene ID - Mouse | ENSMUSG00000040270 |
Gene ID - Rat | ENSRNOG00000006170 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti BACH2 pAb (ATL-HPA058384) | |
Datasheet | Anti BACH2 pAb (ATL-HPA058384) Datasheet (External Link) |
Vendor Page | Anti BACH2 pAb (ATL-HPA058384) at Atlas Antibodies |
Documents & Links for Anti BACH2 pAb (ATL-HPA058384) | |
Datasheet | Anti BACH2 pAb (ATL-HPA058384) Datasheet (External Link) |
Vendor Page | Anti BACH2 pAb (ATL-HPA058384) |