Anti BACH2 pAb (ATL-HPA058384)

Atlas Antibodies

Catalog No: ATL-HPA058384-25

• 

Product Description

Protein Description: BTB and CNC homology 1, basic leucine zipper transcription factor 2
Gene Name: BACH2
Alternative Gene Name: BTBD25
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040270: 85%, ENSRNOG00000006170: 80%
Entrez Gene ID: 60468
Uniprot ID: Q9BYV9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SNSLKPGLARGQIKSEPPSEENEEESITLCLSGDEPDAKDRAGDVEMDRKQPSPAPTPTAPAGAACLERSRSVASPSCLRSLFSITK
• Gene Sequence: SNSLKPGLARGQIKSEPPSEENEEESITLCLSGDEPDAKDRAGDVEMDRKQPSPAPTPTAPAGAACLERSRSVASPSCLRSLFSITK
• Gene ID - Mouse: ENSMUSG00000040270
• Gene ID - Rat: ENSRNOG00000006170
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.