Anti BAALC pAb (ATL-HPA068307)

Atlas Antibodies

Catalog No: ATL-HPA068307-25

• 

Product Description

Protein Description: brain and acute leukemia, cytoplasmic
Gene Name: BAALC
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032826: 31%, ENSRNOG00000004697: 53%
Entrez Gene ID: 79870
Uniprot ID: Q8WXS3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RYYESWTRETESTWLTYTDSDAPPSAAAPDSGPEAGGLHSVLEAEKSKIKAPTDSVSDEGLFSASKMAPLAVFS
• Gene Sequence: RYYESWTRETESTWLTYTDSDAPPSAAAPDSGPEAGGLHSVLEAEKSKIKAPTDSVSDEGLFSASKMAPLAVFS
• Gene ID - Mouse: ENSMUSG00000032826
• Gene ID - Rat: ENSRNOG00000004697
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.