Protein Description: brain and acute leukemia, cytoplasmic
Gene Name: BAALC
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032826: 31%, ENSRNOG00000004697: 53%
Entrez Gene ID: 79870
Uniprot ID: Q8WXS3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: BAALC
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032826: 31%, ENSRNOG00000004697: 53%
Entrez Gene ID: 79870
Uniprot ID: Q8WXS3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | RYYESWTRETESTWLTYTDSDAPPSAAAPDSGPEAGGLHSVLEAEKSKIKAPTDSVSDEGLFSASKMAPLAVFS |
| Documents & Links for Anti BAALC pAb (ATL-HPA068307) | |
| Datasheet | Anti BAALC pAb (ATL-HPA068307) Datasheet (External Link) |
| Vendor Page | Anti BAALC pAb (ATL-HPA068307) at Atlas |
| Documents & Links for Anti BAALC pAb (ATL-HPA068307) | |
| Datasheet | Anti BAALC pAb (ATL-HPA068307) Datasheet (External Link) |
| Vendor Page | Anti BAALC pAb (ATL-HPA068307) |