Anti B4GALT4 pAb (ATL-HPA063546)

Atlas Antibodies

Catalog No: ATL-HPA063546-25

• 

Product Description

Protein Description: UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 4
Gene Name: B4GALT4
Alternative Gene Name: beta4Gal-T4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022793: 80%, ENSRNOG00000003114: 80%
Entrez Gene ID: 8702
Uniprot ID: O60513
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LQRMKISRPLPEVGKYTMVFHTRDKGNEVNAERMKLLHQVSRVWRTDGLSSCSYKLVSVEHNPLYINITVDFWFGA
• Gene Sequence: LQRMKISRPLPEVGKYTMVFHTRDKGNEVNAERMKLLHQVSRVWRTDGLSSCSYKLVSVEHNPLYINITVDFWFGA
• Gene ID - Mouse: ENSMUSG00000022793
• Gene ID - Rat: ENSRNOG00000003114
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.