Description
Product Description
Protein Description: UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 9
Gene Name: B3GNT9
Alternative Gene Name: MGC4655
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000069920: 95%, ENSRNOG00000053895: 95%
Entrez Gene ID: 84752
Uniprot ID: Q6UX72
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: B3GNT9
Alternative Gene Name: MGC4655
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000069920: 95%, ENSRNOG00000053895: 95%
Entrez Gene ID: 84752
Uniprot ID: Q6UX72
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VFLGMCLQRLRLTPEPHPAFRTFGIPQPSAAPHLSTFD |
| Gene Sequence | VFLGMCLQRLRLTPEPHPAFRTFGIPQPSAAPHLSTFD |
| Gene ID - Mouse | ENSMUSG00000069920 |
| Gene ID - Rat | ENSRNOG00000053895 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
| Documents & Links for Anti B3GNT9 pAb (ATL-HPA062734) | |
| Datasheet | Anti B3GNT9 pAb (ATL-HPA062734) Datasheet (External Link) |
| Vendor Page | Anti B3GNT9 pAb (ATL-HPA062734) at Atlas Antibodies |
| Documents & Links for Anti B3GNT9 pAb (ATL-HPA062734) | |
| Datasheet | Anti B3GNT9 pAb (ATL-HPA062734) Datasheet (External Link) |
| Vendor Page | Anti B3GNT9 pAb (ATL-HPA062734) |