Description
Product Description
Protein Description: azurocidin 1
Gene Name: AZU1
Alternative Gene Name: AZAMP, AZU, CAP37, HBP, HUMAZUR, NAZC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020125: 55%, ENSRNOG00000033685: 52%
Entrez Gene ID: 566
Uniprot ID: P20160
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: AZU1
Alternative Gene Name: AZAMP, AZU, CAP37, HBP, HUMAZUR, NAZC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020125: 55%, ENSRNOG00000033685: 52%
Entrez Gene ID: 566
Uniprot ID: P20160
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ALIHARFVMTAASCFQSQNPGVSTVVLGAYDLRRRERQSRQTFSISSMSENGYDPQQNLNDL |
Gene Sequence | ALIHARFVMTAASCFQSQNPGVSTVVLGAYDLRRRERQSRQTFSISSMSENGYDPQQNLNDL |
Gene ID - Mouse | ENSMUSG00000020125 |
Gene ID - Rat | ENSRNOG00000033685 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti AZU1 pAb (ATL-HPA075964 w/enhanced validation) | |
Datasheet | Anti AZU1 pAb (ATL-HPA075964 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti AZU1 pAb (ATL-HPA075964 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti AZU1 pAb (ATL-HPA075964 w/enhanced validation) | |
Datasheet | Anti AZU1 pAb (ATL-HPA075964 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti AZU1 pAb (ATL-HPA075964 w/enhanced validation) |