Anti AXL pAb (ATL-HPA075217)

Atlas Antibodies

Catalog No: ATL-HPA075217-25

• 

Product Description

Protein Description: AXL receptor tyrosine kinase
Gene Name: AXL
Alternative Gene Name: ARK, JTK11, Tyro7, UFO
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002602: 83%, ENSRNOG00000020716: 83%
Entrez Gene ID: 558
Uniprot ID: P30530
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TATITVLPQQPRNLHLVSRQPTELEVAWTPGLSGIYPLTHCTLQAVLSDDGMGIQAGEPDPPEEPLTSQ
• Gene Sequence: TATITVLPQQPRNLHLVSRQPTELEVAWTPGLSGIYPLTHCTLQAVLSDDGMGIQAGEPDPPEEPLTSQ
• Gene ID - Mouse: ENSMUSG00000002602
• Gene ID - Rat: ENSRNOG00000020716
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.