Protein Description: AXL receptor tyrosine kinase
Gene Name: AXL
Alternative Gene Name: ARK, JTK11, Tyro7, UFO
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002602: 83%, ENSRNOG00000020716: 83%
Entrez Gene ID: 558
Uniprot ID: P30530
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: AXL
Alternative Gene Name: ARK, JTK11, Tyro7, UFO
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002602: 83%, ENSRNOG00000020716: 83%
Entrez Gene ID: 558
Uniprot ID: P30530
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | TATITVLPQQPRNLHLVSRQPTELEVAWTPGLSGIYPLTHCTLQAVLSDDGMGIQAGEPDPPEEPLTSQ |
| Documents & Links for Anti AXL pAb (ATL-HPA075217) | |
| Datasheet | Anti AXL pAb (ATL-HPA075217) Datasheet (External Link) |
| Vendor Page | Anti AXL pAb (ATL-HPA075217) at Atlas |
| Documents & Links for Anti AXL pAb (ATL-HPA075217) | |
| Datasheet | Anti AXL pAb (ATL-HPA075217) Datasheet (External Link) |
| Vendor Page | Anti AXL pAb (ATL-HPA075217) |