Protein Description: axonemal dynein light chain domain containing 1
Gene Name: AXDND1
Alternative Gene Name: C1orf125, FLJ32940
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026601: 59%, ENSRNOG00000051405: 43%
Entrez Gene ID: 126859
Uniprot ID: Q5T1B0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: AXDND1
Alternative Gene Name: C1orf125, FLJ32940
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026601: 59%, ENSRNOG00000051405: 43%
Entrez Gene ID: 126859
Uniprot ID: Q5T1B0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | DNGYSKILPSLISSLDFCSFKLENLEFPDTPLEEWQEIDEKINEMKSHLDILLNLTGIVPQHIDVDSVSVLQAYIFNMIQQWLLKIGNEINNGN |
Documents & Links for Anti AXDND1 pAb (ATL-HPA071114 w/enhanced validation) | |
Datasheet | Anti AXDND1 pAb (ATL-HPA071114 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti AXDND1 pAb (ATL-HPA071114 w/enhanced validation) at Atlas |
Documents & Links for Anti AXDND1 pAb (ATL-HPA071114 w/enhanced validation) | |
Datasheet | Anti AXDND1 pAb (ATL-HPA071114 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti AXDND1 pAb (ATL-HPA071114 w/enhanced validation) |