Description
Product Description
Protein Description: acyl-CoA wax alcohol acyltransferase 2
Gene Name: AWAT2
Alternative Gene Name: DGAT2L4, MFAT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031220: 94%, ENSRNOG00000003030: 84%
Entrez Gene ID: 158835
Uniprot ID: Q6E213
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: AWAT2
Alternative Gene Name: DGAT2L4, MFAT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031220: 94%, ENSRNOG00000003030: 84%
Entrez Gene ID: 158835
Uniprot ID: Q6E213
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PLIPAYAFGETDLYDQHIFTPGGFVNRFQKWFQSMVHIYPCAFYGRGFTK |
| Gene Sequence | PLIPAYAFGETDLYDQHIFTPGGFVNRFQKWFQSMVHIYPCAFYGRGFTK |
| Gene ID - Mouse | ENSMUSG00000031220 |
| Gene ID - Rat | ENSRNOG00000003030 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
| Documents & Links for Anti AWAT2 pAb (ATL-HPA062748) | |
| Datasheet | Anti AWAT2 pAb (ATL-HPA062748) Datasheet (External Link) |
| Vendor Page | Anti AWAT2 pAb (ATL-HPA062748) at Atlas Antibodies |
| Documents & Links for Anti AWAT2 pAb (ATL-HPA062748) | |
| Datasheet | Anti AWAT2 pAb (ATL-HPA062748) Datasheet (External Link) |
| Vendor Page | Anti AWAT2 pAb (ATL-HPA062748) |