Anti AWAT1 pAb (ATL-HPA063412)

Atlas Antibodies

Catalog No: ATL-HPA063412-25

• 

Product Description

Protein Description: acyl-CoA wax alcohol acyltransferase 1
Gene Name: AWAT1
Alternative Gene Name: DGAT2L3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015665: 90%, ENSRNOG00000026231: 90%
Entrez Gene ID: 158833
Uniprot ID: Q58HT5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: WVRNWCVWTHIRDYFPITILKTKDLSPEHNYLMGVHPHGLLTFGAFCNFCT
• Gene Sequence: WVRNWCVWTHIRDYFPITILKTKDLSPEHNYLMGVHPHGLLTFGAFCNFCT
• Gene ID - Mouse: ENSMUSG00000015665
• Gene ID - Rat: ENSRNOG00000026231
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.