Protein Description: ataxin 7-like 3
Gene Name: ATXN7L3
Alternative Gene Name: DKFZp761G2113
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059995: 99%, ENSRNOG00000020930: 97%
Entrez Gene ID: 56970
Uniprot ID: Q14CW9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ATXN7L3
Alternative Gene Name: DKFZp761G2113
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059995: 99%, ENSRNOG00000020930: 97%
Entrez Gene ID: 56970
Uniprot ID: Q14CW9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LRSLLTTQCGVISEHTKKMCTRSLRCPQHTDEQRRTVRIYFLGPSAVLPEVESSLDNDSFDMTDSQALISRL |
| Documents & Links for Anti ATXN7L3 pAb (ATL-HPA064316) | |
| Datasheet | Anti ATXN7L3 pAb (ATL-HPA064316) Datasheet (External Link) |
| Vendor Page | Anti ATXN7L3 pAb (ATL-HPA064316) at Atlas |
| Documents & Links for Anti ATXN7L3 pAb (ATL-HPA064316) | |
| Datasheet | Anti ATXN7L3 pAb (ATL-HPA064316) Datasheet (External Link) |
| Vendor Page | Anti ATXN7L3 pAb (ATL-HPA064316) |