Anti ATXN7L3 pAb (ATL-HPA064316)

Catalog No:
ATL-HPA064316-25
$303.00

Description

Product Description

Protein Description: ataxin 7-like 3
Gene Name: ATXN7L3
Alternative Gene Name: DKFZp761G2113
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059995: 99%, ENSRNOG00000020930: 97%
Entrez Gene ID: 56970
Uniprot ID: Q14CW9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LRSLLTTQCGVISEHTKKMCTRSLRCPQHTDEQRRTVRIYFLGPSAVLPEVESSLDNDSFDMTDSQALISRL
Gene Sequence LRSLLTTQCGVISEHTKKMCTRSLRCPQHTDEQRRTVRIYFLGPSAVLPEVESSLDNDSFDMTDSQALISRL
Gene ID - Mouse ENSMUSG00000059995
Gene ID - Rat ENSRNOG00000020930
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti ATXN7L3 pAb (ATL-HPA064316)
Datasheet Anti ATXN7L3 pAb (ATL-HPA064316) Datasheet (External Link)
Vendor Page Anti ATXN7L3 pAb (ATL-HPA064316) at Atlas Antibodies

Documents & Links for Anti ATXN7L3 pAb (ATL-HPA064316)
Datasheet Anti ATXN7L3 pAb (ATL-HPA064316) Datasheet (External Link)
Vendor Page Anti ATXN7L3 pAb (ATL-HPA064316)

Product Description

Protein Description: ataxin 7-like 3
Gene Name: ATXN7L3
Alternative Gene Name: DKFZp761G2113
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059995: 99%, ENSRNOG00000020930: 97%
Entrez Gene ID: 56970
Uniprot ID: Q14CW9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LRSLLTTQCGVISEHTKKMCTRSLRCPQHTDEQRRTVRIYFLGPSAVLPEVESSLDNDSFDMTDSQALISRL
Gene Sequence LRSLLTTQCGVISEHTKKMCTRSLRCPQHTDEQRRTVRIYFLGPSAVLPEVESSLDNDSFDMTDSQALISRL
Gene ID - Mouse ENSMUSG00000059995
Gene ID - Rat ENSRNOG00000020930
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti ATXN7L3 pAb (ATL-HPA064316)
Datasheet Anti ATXN7L3 pAb (ATL-HPA064316) Datasheet (External Link)
Vendor Page Anti ATXN7L3 pAb (ATL-HPA064316) at Atlas Antibodies

Documents & Links for Anti ATXN7L3 pAb (ATL-HPA064316)
Datasheet Anti ATXN7L3 pAb (ATL-HPA064316) Datasheet (External Link)
Vendor Page Anti ATXN7L3 pAb (ATL-HPA064316)