Description
Product Description
Protein Description: ataxin 3
Gene Name: ATXN3
Alternative Gene Name: ATX3, JOS, MJD, SCA3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021189: 78%, ENSRNOG00000005470: 84%
Entrez Gene ID: 4287
Uniprot ID: P54252
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ATXN3
Alternative Gene Name: ATX3, JOS, MJD, SCA3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021189: 78%, ENSRNOG00000005470: 84%
Entrez Gene ID: 4287
Uniprot ID: P54252
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SRQEIDMEDEEADLRRAIQLSMQGSSRNISQDMTQTSGTNLTSEELRKRREAYFE |
| Gene Sequence | SRQEIDMEDEEADLRRAIQLSMQGSSRNISQDMTQTSGTNLTSEELRKRREAYFE |
| Gene ID - Mouse | ENSMUSG00000021189 |
| Gene ID - Rat | ENSRNOG00000005470 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
| Documents & Links for Anti ATXN3 pAb (ATL-HPA069338) | |
| Datasheet | Anti ATXN3 pAb (ATL-HPA069338) Datasheet (External Link) |
| Vendor Page | Anti ATXN3 pAb (ATL-HPA069338) at Atlas Antibodies |
| Documents & Links for Anti ATXN3 pAb (ATL-HPA069338) | |
| Datasheet | Anti ATXN3 pAb (ATL-HPA069338) Datasheet (External Link) |
| Vendor Page | Anti ATXN3 pAb (ATL-HPA069338) |