Description
Product Description
Protein Description: ataxin 1-like
Gene Name: ATXN1L
Alternative Gene Name: BOAT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000069895: 87%, ENSRNOG00000038766: 84%
Entrez Gene ID: 342371
Uniprot ID: P0C7T5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ATXN1L
Alternative Gene Name: BOAT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000069895: 87%, ENSRNOG00000038766: 84%
Entrez Gene ID: 342371
Uniprot ID: P0C7T5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | AHSFNKAPSATSPSGQLPHHSSTQPLDLAPGRMPIYYQMSRLPAGYTLHETPPAGASPVLTPQESQS |
Gene Sequence | AHSFNKAPSATSPSGQLPHHSSTQPLDLAPGRMPIYYQMSRLPAGYTLHETPPAGASPVLTPQESQS |
Gene ID - Mouse | ENSMUSG00000069895 |
Gene ID - Rat | ENSRNOG00000038766 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti ATXN1L pAb (ATL-HPA062596) | |
Datasheet | Anti ATXN1L pAb (ATL-HPA062596) Datasheet (External Link) |
Vendor Page | Anti ATXN1L pAb (ATL-HPA062596) at Atlas Antibodies |
Documents & Links for Anti ATXN1L pAb (ATL-HPA062596) | |
Datasheet | Anti ATXN1L pAb (ATL-HPA062596) Datasheet (External Link) |
Vendor Page | Anti ATXN1L pAb (ATL-HPA062596) |