Anti ATP6V1D pAb (ATL-HPA057316 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA057316-25

• 
• 

Product Description

Protein Description: ATPase, H+ transporting, lysosomal 34kDa, V1 subunit D
Gene Name: ATP6V1D
Alternative Gene Name: ATP6M, VATD, VMA8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021114: 100%, ENSRNOG00000009080: 100%
Entrez Gene ID: 51382
Uniprot ID: Q9Y5K8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VNKAQVKIRAKKDNVAGVTLPVFEHYHEGTDSYELTGLARGGEQLAKLKRNYAKAVELLVELASLQTSFVTLDEAIKIT
• Gene Sequence: VNKAQVKIRAKKDNVAGVTLPVFEHYHEGTDSYELTGLARGGEQLAKLKRNYAKAVELLVELASLQTSFVTLDEAIKIT
• Gene ID - Mouse: ENSMUSG00000021114
• Gene ID - Rat: ENSRNOG00000009080
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.