Anti ATP6V1C2 pAb (ATL-HPA067305)

Atlas Antibodies

Catalog No: ATL-HPA067305-25

• 

Product Description

Protein Description: ATPase H+ transporting V1 subunit C2
Gene Name: ATP6V1C2
Alternative Gene Name: ATP6C2, VMA5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020566: 87%, ENSRNOG00000050553: 89%
Entrez Gene ID: 245973
Uniprot ID: Q8NEY4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YPVKQPLVSVVDTIAKQLAQIEMDLKSRTAAYNTLKTNLENLEKKSMGNLFTRTLSDIVSKED
• Gene Sequence: YPVKQPLVSVVDTIAKQLAQIEMDLKSRTAAYNTLKTNLENLEKKSMGNLFTRTLSDIVSKED
• Gene ID - Mouse: ENSMUSG00000020566
• Gene ID - Rat: ENSRNOG00000050553
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.