Anti ATP6V1C2 pAb (ATL-HPA067305)

Catalog No:
ATL-HPA067305-25
$303.00

Description

Product Description

Protein Description: ATPase H+ transporting V1 subunit C2
Gene Name: ATP6V1C2
Alternative Gene Name: ATP6C2, VMA5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020566: 87%, ENSRNOG00000050553: 89%
Entrez Gene ID: 245973
Uniprot ID: Q8NEY4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YPVKQPLVSVVDTIAKQLAQIEMDLKSRTAAYNTLKTNLENLEKKSMGNLFTRTLSDIVSKED
Gene Sequence YPVKQPLVSVVDTIAKQLAQIEMDLKSRTAAYNTLKTNLENLEKKSMGNLFTRTLSDIVSKED
Gene ID - Mouse ENSMUSG00000020566
Gene ID - Rat ENSRNOG00000050553
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti ATP6V1C2 pAb (ATL-HPA067305)
Datasheet Anti ATP6V1C2 pAb (ATL-HPA067305) Datasheet (External Link)
Vendor Page Anti ATP6V1C2 pAb (ATL-HPA067305) at Atlas Antibodies

Documents & Links for Anti ATP6V1C2 pAb (ATL-HPA067305)
Datasheet Anti ATP6V1C2 pAb (ATL-HPA067305) Datasheet (External Link)
Vendor Page Anti ATP6V1C2 pAb (ATL-HPA067305)

Product Description

Protein Description: ATPase H+ transporting V1 subunit C2
Gene Name: ATP6V1C2
Alternative Gene Name: ATP6C2, VMA5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020566: 87%, ENSRNOG00000050553: 89%
Entrez Gene ID: 245973
Uniprot ID: Q8NEY4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YPVKQPLVSVVDTIAKQLAQIEMDLKSRTAAYNTLKTNLENLEKKSMGNLFTRTLSDIVSKED
Gene Sequence YPVKQPLVSVVDTIAKQLAQIEMDLKSRTAAYNTLKTNLENLEKKSMGNLFTRTLSDIVSKED
Gene ID - Mouse ENSMUSG00000020566
Gene ID - Rat ENSRNOG00000050553
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti ATP6V1C2 pAb (ATL-HPA067305)
Datasheet Anti ATP6V1C2 pAb (ATL-HPA067305) Datasheet (External Link)
Vendor Page Anti ATP6V1C2 pAb (ATL-HPA067305) at Atlas Antibodies

Documents & Links for Anti ATP6V1C2 pAb (ATL-HPA067305)
Datasheet Anti ATP6V1C2 pAb (ATL-HPA067305) Datasheet (External Link)
Vendor Page Anti ATP6V1C2 pAb (ATL-HPA067305)