Description
Product Description
Protein Description: ATP synthase, H+ transporting, mitochondrial F1 complex, gamma polypeptide 1
Gene Name: ATP5C1
Alternative Gene Name: ATP5C, ATP5CL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025781: 91%, ENSRNOG00000019223: 87%
Entrez Gene ID: 509
Uniprot ID: P36542
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ATP5C1
Alternative Gene Name: ATP5C, ATP5CL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025781: 91%, ENSRNOG00000019223: 87%
Entrez Gene ID: 509
Uniprot ID: P36542
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RGILYRTHSDQFLVAFKEVGRKPPTFGDASVIALELLNSGYEFDEGSIIFNKFRSVISYKTEEKPIFSLNTVASA |
Gene Sequence | RGILYRTHSDQFLVAFKEVGRKPPTFGDASVIALELLNSGYEFDEGSIIFNKFRSVISYKTEEKPIFSLNTVASA |
Gene ID - Mouse | ENSMUSG00000025781 |
Gene ID - Rat | ENSRNOG00000019223 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti ATP5C1 pAb (ATL-HPA060949) | |
Datasheet | Anti ATP5C1 pAb (ATL-HPA060949) Datasheet (External Link) |
Vendor Page | Anti ATP5C1 pAb (ATL-HPA060949) at Atlas Antibodies |
Documents & Links for Anti ATP5C1 pAb (ATL-HPA060949) | |
Datasheet | Anti ATP5C1 pAb (ATL-HPA060949) Datasheet (External Link) |
Vendor Page | Anti ATP5C1 pAb (ATL-HPA060949) |