Protein Description: ATPase H+/K+ transporting alpha subunit
Gene Name: ATP4A
Alternative Gene Name: ATP6A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005553: 95%, ENSRNOG00000020985: 93%
Entrez Gene ID: 495
Uniprot ID: P20648
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ATP4A
Alternative Gene Name: ATP6A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005553: 95%, ENSRNOG00000020985: 93%
Entrez Gene ID: 495
Uniprot ID: P20648
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | KKKAGGGGGKRKEKLENMKKEMEINDHQLSVAELEQKYQTSATKGLSASLAAELLLRD |
Documents & Links for Anti ATP4A pAb (ATL-HPA076684 w/enhanced validation) | |
Datasheet | Anti ATP4A pAb (ATL-HPA076684 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ATP4A pAb (ATL-HPA076684 w/enhanced validation) at Atlas |
Documents & Links for Anti ATP4A pAb (ATL-HPA076684 w/enhanced validation) | |
Datasheet | Anti ATP4A pAb (ATL-HPA076684 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ATP4A pAb (ATL-HPA076684 w/enhanced validation) |