Anti ATP2A2 pAb (ATL-HPA067892)

Atlas Antibodies

Catalog No: ATL-HPA067892-25

• 

Product Description

Protein Description: ATPase, Ca++ transporting, cardiac muscle, slow twitch 2
Gene Name: ATP2A2
Alternative Gene Name: ATP2B, DAR, SERCA2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029467: 97%, ENSRNOG00000001285: 100%
Entrez Gene ID: 488
Uniprot ID: P16615
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AWWFIAADGGPRVSFYQLSHFLQCKEDNPDFE
• Gene Sequence: AWWFIAADGGPRVSFYQLSHFLQCKEDNPDFE
• Gene ID - Mouse: ENSMUSG00000029467
• Gene ID - Rat: ENSRNOG00000001285
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.