Protein Description: atlastin GTPase 3
Gene Name: ATL3
Alternative Gene Name: DKFZP564J0863
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024759: 95%, ENSRNOG00000021203: 94%
Entrez Gene ID: 25923
Uniprot ID: Q6DD88
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ATL3
Alternative Gene Name: DKFZP564J0863
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024759: 95%, ENSRNOG00000021203: 94%
Entrez Gene ID: 25923
Uniprot ID: Q6DD88
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | NLAAAASAKDIYYNNMEEVCGGEKPYLSPDILEEKHCEFKQLALDHFKKTKKMGGKDFSFRYQQ |
| Documents & Links for Anti ATL3 pAb (ATL-HPA076616) | |
| Datasheet | Anti ATL3 pAb (ATL-HPA076616) Datasheet (External Link) |
| Vendor Page | Anti ATL3 pAb (ATL-HPA076616) at Atlas |
| Documents & Links for Anti ATL3 pAb (ATL-HPA076616) | |
| Datasheet | Anti ATL3 pAb (ATL-HPA076616) Datasheet (External Link) |
| Vendor Page | Anti ATL3 pAb (ATL-HPA076616) |