Anti ATL2 pAb (ATL-HPA075302)

Atlas Antibodies

Catalog No: ATL-HPA075302-25

• 

Product Description

Protein Description: atlastin GTPase 2
Gene Name: ATL2
Alternative Gene Name: ARL6IP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059811: 92%, ENSRNOG00000006523: 87%
Entrez Gene ID: 64225
Uniprot ID: Q8NHH9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RTSDPSAAVNHVSSTTSLGENYEDDDLVNSDEVMKKPCPVQIVLAHEDDHNFELDEEALEQ
• Gene Sequence: RTSDPSAAVNHVSSTTSLGENYEDDDLVNSDEVMKKPCPVQIVLAHEDDHNFELDEEALEQ
• Gene ID - Mouse: ENSMUSG00000059811
• Gene ID - Rat: ENSRNOG00000006523
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.