Description
Product Description
Protein Description: autophagy related 9A
Gene Name: ATG9A
Alternative Gene Name: APG9L1, FLJ22169
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033124: 100%, ENSRNOG00000018975: 100%
Entrez Gene ID: 79065
Uniprot ID: Q7Z3C6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ATG9A
Alternative Gene Name: APG9L1, FLJ22169
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033124: 100%, ENSRNOG00000018975: 100%
Entrez Gene ID: 79065
Uniprot ID: Q7Z3C6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | IYNICCYWEIHSFYLHALRIPMSALPYCTWQEVQARIVQTQKEHQICIHKRELTELD |
| Gene Sequence | IYNICCYWEIHSFYLHALRIPMSALPYCTWQEVQARIVQTQKEHQICIHKRELTELD |
| Gene ID - Mouse | ENSMUSG00000033124 |
| Gene ID - Rat | ENSRNOG00000018975 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
| Documents & Links for Anti ATG9A pAb (ATL-HPA059551) | |
| Datasheet | Anti ATG9A pAb (ATL-HPA059551) Datasheet (External Link) |
| Vendor Page | Anti ATG9A pAb (ATL-HPA059551) at Atlas Antibodies |
| Documents & Links for Anti ATG9A pAb (ATL-HPA059551) | |
| Datasheet | Anti ATG9A pAb (ATL-HPA059551) Datasheet (External Link) |
| Vendor Page | Anti ATG9A pAb (ATL-HPA059551) |