Protein Description: autophagy related 7
Gene Name: ATG7
Alternative Gene Name: APG7L, DKFZp434N0735, GSA7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030314: 88%, ENSRNOG00000007486: 90%
Entrez Gene ID: 10533
Uniprot ID: O95352
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ATG7
Alternative Gene Name: APG7L, DKFZp434N0735, GSA7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030314: 88%, ENSRNOG00000007486: 90%
Entrez Gene ID: 10533
Uniprot ID: O95352
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | EAPKDIKGYYYNGDSAGLPARLTLEFSAFDMSAPTPARCCPAIGTLYNTNTLESFKTADKKLLLEQAANEIWESIKSGTALENPVLLNKFLLLTFADLKKYHFYYWFCYPALCLPESLPLIQGPVGLDQRFSLKQIEAL |
| Documents & Links for Anti ATG7 pAb (ATL-HPA007639) | |
| Datasheet | Anti ATG7 pAb (ATL-HPA007639) Datasheet (External Link) |
| Vendor Page | Anti ATG7 pAb (ATL-HPA007639) at Atlas |
| Documents & Links for Anti ATG7 pAb (ATL-HPA007639) | |
| Datasheet | Anti ATG7 pAb (ATL-HPA007639) Datasheet (External Link) |
| Vendor Page | Anti ATG7 pAb (ATL-HPA007639) |
| Citations for Anti ATG7 pAb (ATL-HPA007639) – 1 Found |
| Chu, Qiang; Zhang, Shuang; Chen, Meng; Han, Wen; Jia, Ruoyi; Chen, Wen; Zheng, Xiaodong. Cherry Anthocyanins Regulate NAFLD by Promoting Autophagy Pathway. Oxidative Medicine And Cellular Longevity. 2019( 30931080):4825949. PubMed |