Anti ATG4D pAb (ATL-HPA067683)

Atlas Antibodies

Catalog No: ATL-HPA067683-25

• 

Product Description

Protein Description: autophagy related 4D, cysteine peptidase
Gene Name: ATG4D
Alternative Gene Name: APG4-D, APG4D, AUTL4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002820: 90%, ENSRNOG00000047625: 94%
Entrez Gene ID: 84971
Uniprot ID: Q86TL0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LRKAVESCSDVTRLVVYVSQDCTVYKADVARLVARPDPTAEWKSVVILVPV
• Gene Sequence: LRKAVESCSDVTRLVVYVSQDCTVYKADVARLVARPDPTAEWKSVVILVPV
• Gene ID - Mouse: ENSMUSG00000002820
• Gene ID - Rat: ENSRNOG00000047625
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.