Anti ATG4B pAb (ATL-HPA069803)

Catalog No:
ATL-HPA069803-25
$395.00

Description

Product Description

Protein Description: autophagy related 4B, cysteine peptidase
Gene Name: ATG4B
Alternative Gene Name: APG4B, AUTL1, DKFZp586D1822, KIAA0943
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026280: 94%, ENSRNOG00000018403: 94%
Entrez Gene ID: 23192
Uniprot ID: Q9Y4P1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FCKTEDDFNDWCQQVKKLSLLGGALPMFELVELQPSHLACPDVLNLSLDSSDVERLERFFDSEDEDFEILSL
Gene Sequence FCKTEDDFNDWCQQVKKLSLLGGALPMFELVELQPSHLACPDVLNLSLDSSDVERLERFFDSEDEDFEILSL
Gene ID - Mouse ENSMUSG00000026280
Gene ID - Rat ENSRNOG00000018403
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti ATG4B pAb (ATL-HPA069803)
Datasheet Anti ATG4B pAb (ATL-HPA069803) Datasheet (External Link)
Vendor Page Anti ATG4B pAb (ATL-HPA069803) at Atlas Antibodies

Documents & Links for Anti ATG4B pAb (ATL-HPA069803)
Datasheet Anti ATG4B pAb (ATL-HPA069803) Datasheet (External Link)
Vendor Page Anti ATG4B pAb (ATL-HPA069803)

Product Description

Protein Description: autophagy related 4B, cysteine peptidase
Gene Name: ATG4B
Alternative Gene Name: APG4B, AUTL1, DKFZp586D1822, KIAA0943
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026280: 94%, ENSRNOG00000018403: 94%
Entrez Gene ID: 23192
Uniprot ID: Q9Y4P1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FCKTEDDFNDWCQQVKKLSLLGGALPMFELVELQPSHLACPDVLNLSLDSSDVERLERFFDSEDEDFEILSL
Gene Sequence FCKTEDDFNDWCQQVKKLSLLGGALPMFELVELQPSHLACPDVLNLSLDSSDVERLERFFDSEDEDFEILSL
Gene ID - Mouse ENSMUSG00000026280
Gene ID - Rat ENSRNOG00000018403
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti ATG4B pAb (ATL-HPA069803)
Datasheet Anti ATG4B pAb (ATL-HPA069803) Datasheet (External Link)
Vendor Page Anti ATG4B pAb (ATL-HPA069803) at Atlas Antibodies

Documents & Links for Anti ATG4B pAb (ATL-HPA069803)
Datasheet Anti ATG4B pAb (ATL-HPA069803) Datasheet (External Link)
Vendor Page Anti ATG4B pAb (ATL-HPA069803)