Protein Description: autophagy related 4B, cysteine peptidase
Gene Name: ATG4B
Alternative Gene Name: APG4B, AUTL1, DKFZp586D1822, KIAA0943
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026280: 94%, ENSRNOG00000018403: 94%
Entrez Gene ID: 23192
Uniprot ID: Q9Y4P1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ATG4B
Alternative Gene Name: APG4B, AUTL1, DKFZp586D1822, KIAA0943
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026280: 94%, ENSRNOG00000018403: 94%
Entrez Gene ID: 23192
Uniprot ID: Q9Y4P1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | FCKTEDDFNDWCQQVKKLSLLGGALPMFELVELQPSHLACPDVLNLSLDSSDVERLERFFDSEDEDFEILSL |
| Documents & Links for Anti ATG4B pAb (ATL-HPA069803) | |
| Datasheet | Anti ATG4B pAb (ATL-HPA069803) Datasheet (External Link) |
| Vendor Page | Anti ATG4B pAb (ATL-HPA069803) at Atlas |
| Documents & Links for Anti ATG4B pAb (ATL-HPA069803) | |
| Datasheet | Anti ATG4B pAb (ATL-HPA069803) Datasheet (External Link) |
| Vendor Page | Anti ATG4B pAb (ATL-HPA069803) |