Protein Description: autophagy related 4A, cysteine peptidase
Gene Name: ATG4A
Alternative Gene Name: APG4A, AUTL2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079418: 91%, ENSRNOG00000050960: 88%
Entrez Gene ID: 115201
Uniprot ID: Q8WYN0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ATG4A
Alternative Gene Name: APG4A, AUTL2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079418: 91%, ENSRNOG00000050960: 88%
Entrez Gene ID: 115201
Uniprot ID: Q8WYN0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | ESVLSKYEDQITIFTDYLEEYPDTDELVWILGKQHLLKTEKSKLLSDISARLWFTYRRKFSPIGGTG |
| Documents & Links for Anti ATG4A pAb (ATL-HPA064759) | |
| Datasheet | Anti ATG4A pAb (ATL-HPA064759) Datasheet (External Link) |
| Vendor Page | Anti ATG4A pAb (ATL-HPA064759) at Atlas |
| Documents & Links for Anti ATG4A pAb (ATL-HPA064759) | |
| Datasheet | Anti ATG4A pAb (ATL-HPA064759) Datasheet (External Link) |
| Vendor Page | Anti ATG4A pAb (ATL-HPA064759) |