Protein Description: autophagy related 2A
Gene Name: ATG2A
Alternative Gene Name: KIAA0404
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000106907: 76%, ENSRNOG00000060707: 73%
Entrez Gene ID: 23130
Uniprot ID: Q2TAZ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ATG2A
Alternative Gene Name: KIAA0404
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000106907: 76%, ENSRNOG00000060707: 73%
Entrez Gene ID: 23130
Uniprot ID: Q2TAZ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EDLWLIEQDLNQQLQAGAVAEPLSPDPLTNPLLNLDNTDLFFSMAGLTSSVASALSELSLSDVDLASSVRSDMASRRLSAQAHPAGKMAPNPLLDTMRPDSLLKM |
| Gene Sequence | EDLWLIEQDLNQQLQAGAVAEPLSPDPLTNPLLNLDNTDLFFSMAGLTSSVASALSELSLSDVDLASSVRSDMASRRLSAQAHPAGKMAPNPLLDTMRPDSLLKM |
| Gene ID - Mouse | ENSMUSG00000106907 |
| Gene ID - Rat | ENSRNOG00000060707 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ATG2A pAb (ATL-HPA038715) | |
| Datasheet | Anti ATG2A pAb (ATL-HPA038715) Datasheet (External Link) |
| Vendor Page | Anti ATG2A pAb (ATL-HPA038715) at Atlas |
| Documents & Links for Anti ATG2A pAb (ATL-HPA038715) | |
| Datasheet | Anti ATG2A pAb (ATL-HPA038715) Datasheet (External Link) |
| Vendor Page | Anti ATG2A pAb (ATL-HPA038715) |