Description
Product Description
Protein Description: autophagy related 16-like 1 (S. cerevisiae)
Gene Name: ATG16L1
Alternative Gene Name: APG16L, ATG16A, ATG16L, FLJ10035, WDR30
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026289: 90%, ENSRNOG00000017913: 88%
Entrez Gene ID: 55054
Uniprot ID: Q676U5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ATG16L1
Alternative Gene Name: APG16L, ATG16A, ATG16L, FLJ10035, WDR30
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026289: 90%, ENSRNOG00000017913: 88%
Entrez Gene ID: 55054
Uniprot ID: Q676U5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LRIKHQEELTELHKKRGELAQLVIDLNNQMQRKDREMQMNEAKIAECLQTISDLETECLDLRTKLCDLERANQTLKDEYDA |
Gene Sequence | LRIKHQEELTELHKKRGELAQLVIDLNNQMQRKDREMQMNEAKIAECLQTISDLETECLDLRTKLCDLERANQTLKDEYDA |
Gene ID - Mouse | ENSMUSG00000026289 |
Gene ID - Rat | ENSRNOG00000017913 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti ATG16L1 pAb (ATL-HPA063900 w/enhanced validation) | |
Datasheet | Anti ATG16L1 pAb (ATL-HPA063900 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ATG16L1 pAb (ATL-HPA063900 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti ATG16L1 pAb (ATL-HPA063900 w/enhanced validation) | |
Datasheet | Anti ATG16L1 pAb (ATL-HPA063900 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ATG16L1 pAb (ATL-HPA063900 w/enhanced validation) |