Anti ATAD5 pAb (ATL-HPA066823)

Catalog No:
ATL-HPA066823-25
$447.00

Description

Product Description

Protein Description: ATPase family, AAA domain containing 5
Gene Name: ATAD5
Alternative Gene Name: C17orf41, ELG1, FLJ12735, FRAG1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017550: 81%, ENSRNOG00000021903: 83%
Entrez Gene ID: 79915
Uniprot ID: Q96QE3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MLLENNKGIKNSFEQKQITQTKSTNATNSNVKDVGAEEPSRKNATSLILFEEVDVIFDEDAGFLNAIKTFMATTKRPVILTTSDPTFSLMFDGCFEE
Gene Sequence MLLENNKGIKNSFEQKQITQTKSTNATNSNVKDVGAEEPSRKNATSLILFEEVDVIFDEDAGFLNAIKTFMATTKRPVILTTSDPTFSLMFDGCFEE
Gene ID - Mouse ENSMUSG00000017550
Gene ID - Rat ENSRNOG00000021903
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti ATAD5 pAb (ATL-HPA066823)
Datasheet Anti ATAD5 pAb (ATL-HPA066823) Datasheet (External Link)
Vendor Page Anti ATAD5 pAb (ATL-HPA066823) at Atlas Antibodies

Documents & Links for Anti ATAD5 pAb (ATL-HPA066823)
Datasheet Anti ATAD5 pAb (ATL-HPA066823) Datasheet (External Link)
Vendor Page Anti ATAD5 pAb (ATL-HPA066823)

Product Description

Protein Description: ATPase family, AAA domain containing 5
Gene Name: ATAD5
Alternative Gene Name: C17orf41, ELG1, FLJ12735, FRAG1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017550: 81%, ENSRNOG00000021903: 83%
Entrez Gene ID: 79915
Uniprot ID: Q96QE3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MLLENNKGIKNSFEQKQITQTKSTNATNSNVKDVGAEEPSRKNATSLILFEEVDVIFDEDAGFLNAIKTFMATTKRPVILTTSDPTFSLMFDGCFEE
Gene Sequence MLLENNKGIKNSFEQKQITQTKSTNATNSNVKDVGAEEPSRKNATSLILFEEVDVIFDEDAGFLNAIKTFMATTKRPVILTTSDPTFSLMFDGCFEE
Gene ID - Mouse ENSMUSG00000017550
Gene ID - Rat ENSRNOG00000021903
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti ATAD5 pAb (ATL-HPA066823)
Datasheet Anti ATAD5 pAb (ATL-HPA066823) Datasheet (External Link)
Vendor Page Anti ATAD5 pAb (ATL-HPA066823) at Atlas Antibodies

Documents & Links for Anti ATAD5 pAb (ATL-HPA066823)
Datasheet Anti ATAD5 pAb (ATL-HPA066823) Datasheet (External Link)
Vendor Page Anti ATAD5 pAb (ATL-HPA066823)