Description
Product Description
Protein Description: ATPase family, AAA domain containing 5
Gene Name: ATAD5
Alternative Gene Name: C17orf41, ELG1, FLJ12735, FRAG1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017550: 81%, ENSRNOG00000021903: 83%
Entrez Gene ID: 79915
Uniprot ID: Q96QE3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ATAD5
Alternative Gene Name: C17orf41, ELG1, FLJ12735, FRAG1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017550: 81%, ENSRNOG00000021903: 83%
Entrez Gene ID: 79915
Uniprot ID: Q96QE3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MLLENNKGIKNSFEQKQITQTKSTNATNSNVKDVGAEEPSRKNATSLILFEEVDVIFDEDAGFLNAIKTFMATTKRPVILTTSDPTFSLMFDGCFEE |
Gene Sequence | MLLENNKGIKNSFEQKQITQTKSTNATNSNVKDVGAEEPSRKNATSLILFEEVDVIFDEDAGFLNAIKTFMATTKRPVILTTSDPTFSLMFDGCFEE |
Gene ID - Mouse | ENSMUSG00000017550 |
Gene ID - Rat | ENSRNOG00000021903 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti ATAD5 pAb (ATL-HPA066823) | |
Datasheet | Anti ATAD5 pAb (ATL-HPA066823) Datasheet (External Link) |
Vendor Page | Anti ATAD5 pAb (ATL-HPA066823) at Atlas Antibodies |
Documents & Links for Anti ATAD5 pAb (ATL-HPA066823) | |
Datasheet | Anti ATAD5 pAb (ATL-HPA066823) Datasheet (External Link) |
Vendor Page | Anti ATAD5 pAb (ATL-HPA066823) |