Description
Product Description
Protein Description: asparaginase
Gene Name: ASPG
Alternative Gene Name: C14orf76
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037686: 80%, ENSRNOG00000012843: 80%
Entrez Gene ID: 374569
Uniprot ID: Q86U10
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ASPG
Alternative Gene Name: C14orf76
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037686: 80%, ENSRNOG00000012843: 80%
Entrez Gene ID: 374569
Uniprot ID: Q86U10
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VLVPGTGLAAILRTLPMFHDEEHARARGLSEDTLVLPPASRNQRILYTVLECQPLFDSSDMTIAEWVCLAQTIKRHYEQYHGFVVIHGTD |
Gene Sequence | VLVPGTGLAAILRTLPMFHDEEHARARGLSEDTLVLPPASRNQRILYTVLECQPLFDSSDMTIAEWVCLAQTIKRHYEQYHGFVVIHGTD |
Gene ID - Mouse | ENSMUSG00000037686 |
Gene ID - Rat | ENSRNOG00000012843 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti ASPG pAb (ATL-HPA069761 w/enhanced validation) | |
Datasheet | Anti ASPG pAb (ATL-HPA069761 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ASPG pAb (ATL-HPA069761 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti ASPG pAb (ATL-HPA069761 w/enhanced validation) | |
Datasheet | Anti ASPG pAb (ATL-HPA069761 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ASPG pAb (ATL-HPA069761 w/enhanced validation) |