Anti ASPG pAb (ATL-HPA069761 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA069761-100

• 
• 

Product Description

Protein Description: asparaginase
Gene Name: ASPG
Alternative Gene Name: C14orf76
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037686: 80%, ENSRNOG00000012843: 80%
Entrez Gene ID: 374569
Uniprot ID: Q86U10
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VLVPGTGLAAILRTLPMFHDEEHARARGLSEDTLVLPPASRNQRILYTVLECQPLFDSSDMTIAEWVCLAQTIKRHYEQYHGFVVIHGTD
• Gene Sequence: VLVPGTGLAAILRTLPMFHDEEHARARGLSEDTLVLPPASRNQRILYTVLECQPLFDSSDMTIAEWVCLAQTIKRHYEQYHGFVVIHGTD
• Gene ID - Mouse: ENSMUSG00000037686
• Gene ID - Rat: ENSRNOG00000012843
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.