![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG<br/>Lane 4: Human plasma<br/>Lane 5: Human Liver tissue](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/100479/180379/atl-hpa069761_anti-aspg-pab-atl-hpa069761-wenhanced-validation_62043__31727.1681136375.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG<br/>Lane 4: Human plasma<br/>Lane 5: Human Liver tissue")
Protein Description: asparaginase
Gene Name: ASPG
Alternative Gene Name: C14orf76
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037686: 80%, ENSRNOG00000012843: 80%
Entrez Gene ID: 374569
Uniprot ID: Q86U10
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ASPG
Alternative Gene Name: C14orf76
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037686: 80%, ENSRNOG00000012843: 80%
Entrez Gene ID: 374569
Uniprot ID: Q86U10
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | VLVPGTGLAAILRTLPMFHDEEHARARGLSEDTLVLPPASRNQRILYTVLECQPLFDSSDMTIAEWVCLAQTIKRHYEQYHGFVVIHGTD |
| Documents & Links for Anti ASPG pAb (ATL-HPA069761 w/enhanced validation) | |
| Datasheet | Anti ASPG pAb (ATL-HPA069761 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ASPG pAb (ATL-HPA069761 w/enhanced validation) at Atlas |
| Documents & Links for Anti ASPG pAb (ATL-HPA069761 w/enhanced validation) | |
| Datasheet | Anti ASPG pAb (ATL-HPA069761 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ASPG pAb (ATL-HPA069761 w/enhanced validation) |