Protein Description: asparagine synthetase domain containing 1
Gene Name: ASNSD1
Alternative Gene Name: FLJ20752, NBLA00058, NS3TP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000099913: 84%, ENSRNOG00000003942: 82%
Entrez Gene ID: 54529
Uniprot ID: Q9NWL6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ASNSD1
Alternative Gene Name: FLJ20752, NBLA00058, NS3TP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000099913: 84%, ENSRNOG00000003942: 82%
Entrez Gene ID: 54529
Uniprot ID: Q9NWL6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | KLRRTRICHLIRPLDTVLDDSIGCAVWFASRGIGWLVAQEGVKSYQSNAKVVLTGIGADEQLAGYSRHRVRFQSHGLEGLNKE |
| Documents & Links for Anti ASNSD1 pAb (ATL-HPA075042) | |
| Datasheet | Anti ASNSD1 pAb (ATL-HPA075042) Datasheet (External Link) |
| Vendor Page | Anti ASNSD1 pAb (ATL-HPA075042) at Atlas |
| Documents & Links for Anti ASNSD1 pAb (ATL-HPA075042) | |
| Datasheet | Anti ASNSD1 pAb (ATL-HPA075042) Datasheet (External Link) |
| Vendor Page | Anti ASNSD1 pAb (ATL-HPA075042) |