Anti ASNSD1 pAb (ATL-HPA075042)

Catalog No:
ATL-HPA075042-25
$447.00

Description

Product Description

Protein Description: asparagine synthetase domain containing 1
Gene Name: ASNSD1
Alternative Gene Name: FLJ20752, NBLA00058, NS3TP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000099913: 84%, ENSRNOG00000003942: 82%
Entrez Gene ID: 54529
Uniprot ID: Q9NWL6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KLRRTRICHLIRPLDTVLDDSIGCAVWFASRGIGWLVAQEGVKSYQSNAKVVLTGIGADEQLAGYSRHRVRFQSHGLEGLNKE
Gene Sequence KLRRTRICHLIRPLDTVLDDSIGCAVWFASRGIGWLVAQEGVKSYQSNAKVVLTGIGADEQLAGYSRHRVRFQSHGLEGLNKE
Gene ID - Mouse ENSMUSG00000099913
Gene ID - Rat ENSRNOG00000003942
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti ASNSD1 pAb (ATL-HPA075042)
Datasheet Anti ASNSD1 pAb (ATL-HPA075042) Datasheet (External Link)
Vendor Page Anti ASNSD1 pAb (ATL-HPA075042) at Atlas Antibodies

Documents & Links for Anti ASNSD1 pAb (ATL-HPA075042)
Datasheet Anti ASNSD1 pAb (ATL-HPA075042) Datasheet (External Link)
Vendor Page Anti ASNSD1 pAb (ATL-HPA075042)

Product Description

Protein Description: asparagine synthetase domain containing 1
Gene Name: ASNSD1
Alternative Gene Name: FLJ20752, NBLA00058, NS3TP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000099913: 84%, ENSRNOG00000003942: 82%
Entrez Gene ID: 54529
Uniprot ID: Q9NWL6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KLRRTRICHLIRPLDTVLDDSIGCAVWFASRGIGWLVAQEGVKSYQSNAKVVLTGIGADEQLAGYSRHRVRFQSHGLEGLNKE
Gene Sequence KLRRTRICHLIRPLDTVLDDSIGCAVWFASRGIGWLVAQEGVKSYQSNAKVVLTGIGADEQLAGYSRHRVRFQSHGLEGLNKE
Gene ID - Mouse ENSMUSG00000099913
Gene ID - Rat ENSRNOG00000003942
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti ASNSD1 pAb (ATL-HPA075042)
Datasheet Anti ASNSD1 pAb (ATL-HPA075042) Datasheet (External Link)
Vendor Page Anti ASNSD1 pAb (ATL-HPA075042) at Atlas Antibodies

Documents & Links for Anti ASNSD1 pAb (ATL-HPA075042)
Datasheet Anti ASNSD1 pAb (ATL-HPA075042) Datasheet (External Link)
Vendor Page Anti ASNSD1 pAb (ATL-HPA075042)