Protein Description: acid-sensing (proton-gated) ion channel 2
Gene Name: ASIC2
Alternative Gene Name: ACCN, ACCN1, ASIC2a, BNaC1, BNC1, hBNaC1, MDEG
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020704: 99%, ENSRNOG00000059765: 51%
Entrez Gene ID: 40
Uniprot ID: Q16515
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ASIC2
Alternative Gene Name: ACCN, ACCN1, ASIC2a, BNaC1, BNC1, hBNaC1, MDEG
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020704: 99%, ENSRNOG00000059765: 51%
Entrez Gene ID: 40
Uniprot ID: Q16515
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LLDVNLQIPDPHLADPSVLEALRQKANFKHYKPKQFSMLEFLHRVGHDLKDMMLYCKFKGQECGHQDFTTVFTKY |
| Documents & Links for Anti ASIC2 pAb (ATL-HPA052112 w/enhanced validation) | |
| Datasheet | Anti ASIC2 pAb (ATL-HPA052112 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ASIC2 pAb (ATL-HPA052112 w/enhanced validation) at Atlas |
| Documents & Links for Anti ASIC2 pAb (ATL-HPA052112 w/enhanced validation) | |
| Datasheet | Anti ASIC2 pAb (ATL-HPA052112 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ASIC2 pAb (ATL-HPA052112 w/enhanced validation) |