Anti ASIC2 pAb (ATL-HPA052112 w/enhanced validation)

Catalog No:
ATL-HPA052112-25
$303.00

On sale now! 25% off. Add item to cart to see discounted price. Valid thru Mar 2025.

Protein Description: acid-sensing (proton-gated) ion channel 2
Gene Name: ASIC2
Alternative Gene Name: ACCN, ACCN1, ASIC2a, BNaC1, BNC1, hBNaC1, MDEG
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020704: 99%, ENSRNOG00000059765: 51%
Entrez Gene ID: 40
Uniprot ID: Q16515
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence LLDVNLQIPDPHLADPSVLEALRQKANFKHYKPKQFSMLEFLHRVGHDLKDMMLYCKFKGQECGHQDFTTVFTKY
Gene ID - Mouse ENSMUSG00000020704
Gene ID - Rat ENSMUSG00000020704
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Documents & Links for Anti ASIC2 pAb (ATL-HPA052112 w/enhanced validation)
Datasheet Anti ASIC2 pAb (ATL-HPA052112 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ASIC2 pAb (ATL-HPA052112 w/enhanced validation) at Atlas

Documents & Links for Anti ASIC2 pAb (ATL-HPA052112 w/enhanced validation)
Datasheet Anti ASIC2 pAb (ATL-HPA052112 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ASIC2 pAb (ATL-HPA052112 w/enhanced validation)