Anti ASIC1 pAb (ATL-HPA058870)

Atlas Antibodies

Catalog No: ATL-HPA058870-25

• 

Product Description

Protein Description: acid sensing (proton gated) ion channel 1
Gene Name: ASIC1
Alternative Gene Name: ACCN2, BNaC2, hBNaC2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023017: 99%, ENSRNOG00000059765: 99%
Entrez Gene ID: 41
Uniprot ID: P78348
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LALLNNRYEIPDTQMADEKQLEILQDKANFRSFKPKPFNMREFYDRAGHDIRDMLLSCHFRGEVCSAEDFKVVFT
• Gene Sequence: LALLNNRYEIPDTQMADEKQLEILQDKANFRSFKPKPFNMREFYDRAGHDIRDMLLSCHFRGEVCSAEDFKVVFT
• Gene ID - Mouse: ENSMUSG00000023017
• Gene ID - Rat: ENSRNOG00000059765
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations

Citations for Anti ASIC1 pAb (ATL-HPA058870) – 1 Found

Zhang, Xiao-Hua; Šarić, Tomo; Mehrjardi, Narges Zare; Hamad, Sarkawt; Morad, Martin. Acid-Sensitive Ion Channels Are Expressed in Human Induced Pluripotent Stem Cell-Derived Cardiomyocytes. Stem Cells And Development. 2019;28(14):920-932.