Description
Product Description
Protein Description: achaete-scute family bHLH transcription factor 1
Gene Name: ASCL1
Alternative Gene Name: ASH1, bHLHa46, HASH1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020052: 97%, ENSRNOG00000004294: 97%
Entrez Gene ID: 429
Uniprot ID: P50553
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ASCL1
Alternative Gene Name: ASH1, bHLHa46, HASH1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020052: 97%, ENSRNOG00000004294: 97%
Entrez Gene ID: 429
Uniprot ID: P50553
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GGHKSAPKQVKRQRSSSPELMRCKRRLNFSGFGYSL |
Gene Sequence | GGHKSAPKQVKRQRSSSPELMRCKRRLNFSGFGYSL |
Gene ID - Mouse | ENSMUSG00000020052 |
Gene ID - Rat | ENSRNOG00000004294 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti ASCL1 pAb (ATL-HPA076307) | |
Datasheet | Anti ASCL1 pAb (ATL-HPA076307) Datasheet (External Link) |
Vendor Page | Anti ASCL1 pAb (ATL-HPA076307) at Atlas Antibodies |
Documents & Links for Anti ASCL1 pAb (ATL-HPA076307) | |
Datasheet | Anti ASCL1 pAb (ATL-HPA076307) Datasheet (External Link) |
Vendor Page | Anti ASCL1 pAb (ATL-HPA076307) |