Description
Product Description
Protein Description: ankyrin repeat and SOCS box containing 9
Gene Name: ASB9
Alternative Gene Name: DKFZP564L0862, FLJ20636, MGC4954
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031384: 72%, ENSRNOG00000003452: 72%
Entrez Gene ID: 140462
Uniprot ID: Q96DX5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ASB9
Alternative Gene Name: DKFZP564L0862, FLJ20636, MGC4954
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031384: 72%, ENSRNOG00000003452: 72%
Entrez Gene ID: 140462
Uniprot ID: Q96DX5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GMDGSKPAGPRDFPGIRLLSNPLMGDAVSDWSPMHEAAIHGHQLSLRNLISQGWAVNIITADHVSPLHEACLGGHLSCVKILLKHGAQVNGVTADWHTPLFNACV |
Gene Sequence | GMDGSKPAGPRDFPGIRLLSNPLMGDAVSDWSPMHEAAIHGHQLSLRNLISQGWAVNIITADHVSPLHEACLGGHLSCVKILLKHGAQVNGVTADWHTPLFNACV |
Gene ID - Mouse | ENSMUSG00000031384 |
Gene ID - Rat | ENSRNOG00000003452 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti ASB9 pAb (ATL-HPA003014 w/enhanced validation) | |
Datasheet | Anti ASB9 pAb (ATL-HPA003014 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ASB9 pAb (ATL-HPA003014 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti ASB9 pAb (ATL-HPA003014 w/enhanced validation) | |
Datasheet | Anti ASB9 pAb (ATL-HPA003014 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ASB9 pAb (ATL-HPA003014 w/enhanced validation) |