Anti ASB18 pAb (ATL-HPA068447)

Atlas Antibodies

Catalog No: ATL-HPA068447-25

• 

Product Description

Protein Description: ankyrin repeat and SOCS box containing 18
Gene Name: ASB18
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000067081: 72%, ENSRNOG00000019557: 71%
Entrez Gene ID: 401036
Uniprot ID: Q6ZVZ8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DYLHDYPLNSDLVKRLKSALDAKDEERVRDLICTEITPVDAVIELANDDWMKDPSAQLPTGMLLGDLD
• Gene Sequence: DYLHDYPLNSDLVKRLKSALDAKDEERVRDLICTEITPVDAVIELANDDWMKDPSAQLPTGMLLGDLD
• Gene ID - Mouse: ENSMUSG00000067081
• Gene ID - Rat: ENSRNOG00000019557
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.