Protein Description: ArfGAP with SH3 domain, ankyrin repeat and PH domain 3
Gene Name: ASAP3
Alternative Gene Name: CENTB6, DDEFL1, FLJ20199, UPLC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036995: 70%, ENSRNOG00000049714: 66%
Entrez Gene ID: 55616
Uniprot ID: Q8TDY4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ASAP3
Alternative Gene Name: CENTB6, DDEFL1, FLJ20199, UPLC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036995: 70%, ENSRNOG00000049714: 66%
Entrez Gene ID: 55616
Uniprot ID: Q8TDY4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | KKHHKECEELLEQAQAGTFAFPLHVDYSWVISTEPGSDSEEDEEEKRCLLKLPAQAHWASGRLDISNKTYETVASLGAATPQGESEDCPPPLPVKNSSRTLVQGCAR |
Documents & Links for Anti ASAP3 pAb (ATL-HPA020546) | |
Datasheet | Anti ASAP3 pAb (ATL-HPA020546) Datasheet (External Link) |
Vendor Page | Anti ASAP3 pAb (ATL-HPA020546) at Atlas |
Documents & Links for Anti ASAP3 pAb (ATL-HPA020546) | |
Datasheet | Anti ASAP3 pAb (ATL-HPA020546) Datasheet (External Link) |
Vendor Page | Anti ASAP3 pAb (ATL-HPA020546) |