Polyclonal Antibody against Human ASAP2, Gene description: ArfGAP with SH3 domain, ankyrin repeat and PH domain 2, Alternative Gene Names: CENTB3, DDEF2, KIAA0400, PAP, SHAG1, Validated applications: ICC, Uniprot ID: O43150, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | WRLLHEDLDESDDDMDEKLQPSPNRREDRPISFYQLGSNQLQSNAVSLARDAANLAKDKQRAFMPSILQNETY |
Gene ID - Mouse | ENSMUSG00000052632 |
Gene ID - Rat | ENSMUSG00000052632 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti-ASAP2 pAb (ATL-HPA068383) | |
Vendor Page | Anti-ASAP2 pAb (ATL-HPA068383) at Atlas |
Documents & Links for Anti-ASAP2 pAb (ATL-HPA068383) | |
Vendor Page | Anti-ASAP2 pAb (ATL-HPA068383) |