Polyclonal Antibody against Human ASAP2, Gene description: ArfGAP with SH3 domain, ankyrin repeat and PH domain 2, Alternative Gene Names: CENTB3, DDEF2, KIAA0400, PAP, SHAG1, Validated applications: ICC, Uniprot ID: O43150, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | WRLLHEDLDESDDDMDEKLQPSPNRREDRPISFYQLGSNQLQSNAVSLARDAANLAKDKQRAFMPSILQNETY |
| Documents & Links for Anti-ASAP2 pAb (ATL-HPA068383) | |
| Vendor Page | Anti-ASAP2 pAb (ATL-HPA068383) at Atlas |
| Documents & Links for Anti-ASAP2 pAb (ATL-HPA068383) | |
| Vendor Page | Anti-ASAP2 pAb (ATL-HPA068383) |