Protein Description: armadillo repeat gene deleted in velocardiofacial syndrome
Gene Name: ARVCF
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000098615: 81%, ENSRNOG00000001888: 81%
Entrez Gene ID: 421
Uniprot ID: O00192
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ARVCF
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000098615: 81%, ENSRNOG00000001888: 81%
Entrez Gene ID: 421
Uniprot ID: O00192
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | DDTRSLAADDEGGPELEPDYGTATRRRPECGRGLHTRAYEDTADDGGELADERPAFPMVTAP |
| Documents & Links for Anti ARVCF pAb (ATL-HPA063675 w/enhanced validation) | |
| Datasheet | Anti ARVCF pAb (ATL-HPA063675 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ARVCF pAb (ATL-HPA063675 w/enhanced validation) at Atlas |
| Documents & Links for Anti ARVCF pAb (ATL-HPA063675 w/enhanced validation) | |
| Datasheet | Anti ARVCF pAb (ATL-HPA063675 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ARVCF pAb (ATL-HPA063675 w/enhanced validation) |