Protein Description: ADP-ribosyltransferase 3
Gene Name: ART3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034842: 68%, ENSRNOG00000002256: 62%
Entrez Gene ID: 419
Uniprot ID: Q13508
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ART3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034842: 68%, ENSRNOG00000002256: 62%
Entrez Gene ID: 419
Uniprot ID: Q13508
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | FHFYLTRALQLLRKPCEASSKTVVYRTSQGTSFTFGGLNQARFGHFTLAYSAKPQAANDQLTVLSIYTCLGVDIENFLDKESERITLIPLNEVFQVSQEGAGNNLILQSINKTCSHYECAFLGGLKTENCIENLEYFQPIYVYNPGEK |
Documents & Links for Anti ART3 pAb (ATL-HPA011268 w/enhanced validation) | |
Datasheet | Anti ART3 pAb (ATL-HPA011268 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ART3 pAb (ATL-HPA011268 w/enhanced validation) at Atlas |
Documents & Links for Anti ART3 pAb (ATL-HPA011268 w/enhanced validation) | |
Datasheet | Anti ART3 pAb (ATL-HPA011268 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ART3 pAb (ATL-HPA011268 w/enhanced validation) |