Anti ARSE pAb (ATL-HPA070651)

Atlas Antibodies

Catalog No: ATL-HPA070651-25

• 

Product Description

Protein Description: arylsulfatase E (chondrodysplasia punctata 1)
Gene Name: ARSE
Alternative Gene Name: CDPX, CDPX1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040896: 32%, ENSRNOG00000028350: 52%
Entrez Gene ID: 415
Uniprot ID: P51690
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HFYGMPFSLMGDCARWELSEKRVNLEQKLNFLF
• Gene Sequence: HFYGMPFSLMGDCARWELSEKRVNLEQKLNFLF
• Gene ID - Mouse: ENSMUSG00000040896
• Gene ID - Rat: ENSRNOG00000028350
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.