Description
Product Description
Protein Description: arylsulfatase E (chondrodysplasia punctata 1)
Gene Name: ARSE
Alternative Gene Name: CDPX, CDPX1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040896: 32%, ENSRNOG00000028350: 52%
Entrez Gene ID: 415
Uniprot ID: P51690
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ARSE
Alternative Gene Name: CDPX, CDPX1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040896: 32%, ENSRNOG00000028350: 52%
Entrez Gene ID: 415
Uniprot ID: P51690
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | HFYGMPFSLMGDCARWELSEKRVNLEQKLNFLF |
Gene Sequence | HFYGMPFSLMGDCARWELSEKRVNLEQKLNFLF |
Gene ID - Mouse | ENSMUSG00000040896 |
Gene ID - Rat | ENSRNOG00000028350 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti ARSE pAb (ATL-HPA070651) | |
Datasheet | Anti ARSE pAb (ATL-HPA070651) Datasheet (External Link) |
Vendor Page | Anti ARSE pAb (ATL-HPA070651) at Atlas Antibodies |
Documents & Links for Anti ARSE pAb (ATL-HPA070651) | |
Datasheet | Anti ARSE pAb (ATL-HPA070651) Datasheet (External Link) |
Vendor Page | Anti ARSE pAb (ATL-HPA070651) |