Protein Description: arylsulfatase D
Gene Name: ARSD
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034295: 38%, ENSRNOG00000002248: 39%
Entrez Gene ID: 414
Uniprot ID: P51689
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ARSD
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034295: 38%, ENSRNOG00000002248: 39%
Entrez Gene ID: 414
Uniprot ID: P51689
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | FYGMPFTLTNDCDPGRPPEVDAALRAQLWGYTQFL |
| Documents & Links for Anti ARSD pAb (ATL-HPA063835) | |
| Datasheet | Anti ARSD pAb (ATL-HPA063835) Datasheet (External Link) |
| Vendor Page | Anti ARSD pAb (ATL-HPA063835) at Atlas |
| Documents & Links for Anti ARSD pAb (ATL-HPA063835) | |
| Datasheet | Anti ARSD pAb (ATL-HPA063835) Datasheet (External Link) |
| Vendor Page | Anti ARSD pAb (ATL-HPA063835) |