Protein Description: arrestin domain containing 2
Gene Name: ARRDC2
Alternative Gene Name: CLONE24945, PP2703
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002910: 82%, ENSRNOG00000019009: 83%
Entrez Gene ID: 27106
Uniprot ID: Q8TBH0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ARRDC2
Alternative Gene Name: CLONE24945, PP2703
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002910: 82%, ENSRNOG00000019009: 83%
Entrez Gene ID: 27106
Uniprot ID: Q8TBH0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | MLFDKVKAFSVQLDGATAGVEPVFSGGQAVAGRVLLELSSAARVGALRLRARGRAHVHWT |
Documents & Links for Anti ARRDC2 pAb (ATL-HPA074216) | |
Datasheet | Anti ARRDC2 pAb (ATL-HPA074216) Datasheet (External Link) |
Vendor Page | Anti ARRDC2 pAb (ATL-HPA074216) at Atlas |
Documents & Links for Anti ARRDC2 pAb (ATL-HPA074216) | |
Datasheet | Anti ARRDC2 pAb (ATL-HPA074216) Datasheet (External Link) |
Vendor Page | Anti ARRDC2 pAb (ATL-HPA074216) |