Anti ARR3 pAb (ATL-HPA063129)

Catalog No:
ATL-HPA063129-25
$447.00

Description

Product Description

Protein Description: arrestin 3
Gene Name: ARR3
Alternative Gene Name: ARRX
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060890: 85%, ENSRNOG00000002904: 85%
Entrez Gene ID: 407
Uniprot ID: P36575
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KDLYVQTLQVVPAESSSPQGPLTVLQERLLHKLGDNAYPFTLQMVTNLPCSVT
Gene Sequence KDLYVQTLQVVPAESSSPQGPLTVLQERLLHKLGDNAYPFTLQMVTNLPCSVT
Gene ID - Mouse ENSMUSG00000060890
Gene ID - Rat ENSRNOG00000002904
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti ARR3 pAb (ATL-HPA063129)
Datasheet Anti ARR3 pAb (ATL-HPA063129) Datasheet (External Link)
Vendor Page Anti ARR3 pAb (ATL-HPA063129) at Atlas Antibodies

Documents & Links for Anti ARR3 pAb (ATL-HPA063129)
Datasheet Anti ARR3 pAb (ATL-HPA063129) Datasheet (External Link)
Vendor Page Anti ARR3 pAb (ATL-HPA063129)

Product Description

Protein Description: arrestin 3
Gene Name: ARR3
Alternative Gene Name: ARRX
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060890: 85%, ENSRNOG00000002904: 85%
Entrez Gene ID: 407
Uniprot ID: P36575
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KDLYVQTLQVVPAESSSPQGPLTVLQERLLHKLGDNAYPFTLQMVTNLPCSVT
Gene Sequence KDLYVQTLQVVPAESSSPQGPLTVLQERLLHKLGDNAYPFTLQMVTNLPCSVT
Gene ID - Mouse ENSMUSG00000060890
Gene ID - Rat ENSRNOG00000002904
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti ARR3 pAb (ATL-HPA063129)
Datasheet Anti ARR3 pAb (ATL-HPA063129) Datasheet (External Link)
Vendor Page Anti ARR3 pAb (ATL-HPA063129) at Atlas Antibodies

Documents & Links for Anti ARR3 pAb (ATL-HPA063129)
Datasheet Anti ARR3 pAb (ATL-HPA063129) Datasheet (External Link)
Vendor Page Anti ARR3 pAb (ATL-HPA063129)