Description
Product Description
Protein Description: arrestin 3
Gene Name: ARR3
Alternative Gene Name: ARRX
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060890: 85%, ENSRNOG00000002904: 85%
Entrez Gene ID: 407
Uniprot ID: P36575
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ARR3
Alternative Gene Name: ARRX
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060890: 85%, ENSRNOG00000002904: 85%
Entrez Gene ID: 407
Uniprot ID: P36575
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KDLYVQTLQVVPAESSSPQGPLTVLQERLLHKLGDNAYPFTLQMVTNLPCSVT |
Gene Sequence | KDLYVQTLQVVPAESSSPQGPLTVLQERLLHKLGDNAYPFTLQMVTNLPCSVT |
Gene ID - Mouse | ENSMUSG00000060890 |
Gene ID - Rat | ENSRNOG00000002904 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti ARR3 pAb (ATL-HPA063129) | |
Datasheet | Anti ARR3 pAb (ATL-HPA063129) Datasheet (External Link) |
Vendor Page | Anti ARR3 pAb (ATL-HPA063129) at Atlas Antibodies |
Documents & Links for Anti ARR3 pAb (ATL-HPA063129) | |
Datasheet | Anti ARR3 pAb (ATL-HPA063129) Datasheet (External Link) |
Vendor Page | Anti ARR3 pAb (ATL-HPA063129) |