Description
Product Description
Protein Description: cAMP-regulated phosphoprotein, 19kDa
Gene Name: ARPP19
Alternative Gene Name: ARPP-16, ARPP-19, ARPP16, ENSAL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007656: 100%, ENSRNOG00000023086: 100%
Entrez Gene ID: 10776
Uniprot ID: P56211
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ARPP19
Alternative Gene Name: ARPP-16, ARPP-19, ARPP16, ENSAL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007656: 100%, ENSRNOG00000023086: 100%
Entrez Gene ID: 10776
Uniprot ID: P56211
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MSAEVPEAASAEEQKEMEDKVTSPEKAEEAK |
| Gene Sequence | MSAEVPEAASAEEQKEMEDKVTSPEKAEEAK |
| Gene ID - Mouse | ENSMUSG00000007656 |
| Gene ID - Rat | ENSRNOG00000023086 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
| Documents & Links for Anti ARPP19 pAb (ATL-HPA056851) | |
| Datasheet | Anti ARPP19 pAb (ATL-HPA056851) Datasheet (External Link) |
| Vendor Page | Anti ARPP19 pAb (ATL-HPA056851) at Atlas Antibodies |
| Documents & Links for Anti ARPP19 pAb (ATL-HPA056851) | |
| Datasheet | Anti ARPP19 pAb (ATL-HPA056851) Datasheet (External Link) |
| Vendor Page | Anti ARPP19 pAb (ATL-HPA056851) |