Description
Product Description
Protein Description: aryl hydrocarbon receptor nuclear translocator-like 2
Gene Name: ARNTL2
Alternative Gene Name: bHLHe6, BMAL2, CLIF, MOP9, PASD9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040187: 75%, ENSRNOG00000001830: 65%
Entrez Gene ID: 56938
Uniprot ID: Q8WYA1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ARNTL2
Alternative Gene Name: bHLHe6, BMAL2, CLIF, MOP9, PASD9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040187: 75%, ENSRNOG00000001830: 65%
Entrez Gene ID: 56938
Uniprot ID: Q8WYA1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | IVSVNTLVLGHSEPGEASFLPCSSQSSEESSRQSCMSVPGMSTGTVLGAGSIGTDIANEILD |
Gene Sequence | IVSVNTLVLGHSEPGEASFLPCSSQSSEESSRQSCMSVPGMSTGTVLGAGSIGTDIANEILD |
Gene ID - Mouse | ENSMUSG00000040187 |
Gene ID - Rat | ENSRNOG00000001830 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti ARNTL2 pAb (ATL-HPA065355) | |
Datasheet | Anti ARNTL2 pAb (ATL-HPA065355) Datasheet (External Link) |
Vendor Page | Anti ARNTL2 pAb (ATL-HPA065355) at Atlas Antibodies |
Documents & Links for Anti ARNTL2 pAb (ATL-HPA065355) | |
Datasheet | Anti ARNTL2 pAb (ATL-HPA065355) Datasheet (External Link) |
Vendor Page | Anti ARNTL2 pAb (ATL-HPA065355) |