Protein Description: aryl hydrocarbon receptor nuclear translocator-like 2
Gene Name: ARNTL2
Alternative Gene Name: bHLHe6, BMAL2, CLIF, MOP9, PASD9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040187: 75%, ENSRNOG00000001830: 65%
Entrez Gene ID: 56938
Uniprot ID: Q8WYA1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ARNTL2
Alternative Gene Name: bHLHe6, BMAL2, CLIF, MOP9, PASD9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040187: 75%, ENSRNOG00000001830: 65%
Entrez Gene ID: 56938
Uniprot ID: Q8WYA1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | IVSVNTLVLGHSEPGEASFLPCSSQSSEESSRQSCMSVPGMSTGTVLGAGSIGTDIANEILD |
| Documents & Links for Anti ARNTL2 pAb (ATL-HPA065355) | |
| Datasheet | Anti ARNTL2 pAb (ATL-HPA065355) Datasheet (External Link) |
| Vendor Page | Anti ARNTL2 pAb (ATL-HPA065355) at Atlas |
| Documents & Links for Anti ARNTL2 pAb (ATL-HPA065355) | |
| Datasheet | Anti ARNTL2 pAb (ATL-HPA065355) Datasheet (External Link) |
| Vendor Page | Anti ARNTL2 pAb (ATL-HPA065355) |