Protein Description: armadillo repeat containing 12
Gene Name: ARMC12
Alternative Gene Name: C6orf81, FLJ25390
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024223: 78%, ENSRNOG00000000508: 77%
Entrez Gene ID: 221481
Uniprot ID: Q5T9G4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ARMC12
Alternative Gene Name: C6orf81, FLJ25390
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024223: 78%, ENSRNOG00000000508: 77%
Entrez Gene ID: 221481
Uniprot ID: Q5T9G4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | QYLGQLDIRKSVVSLATGAGAIYLLYKAIKAGIKCKPPLCSNSPICIARLAVERERHGRDSGELRRLLNSLECKQDEYA |
Documents & Links for Anti ARMC12 pAb (ATL-HPA075457 w/enhanced validation) | |
Datasheet | Anti ARMC12 pAb (ATL-HPA075457 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ARMC12 pAb (ATL-HPA075457 w/enhanced validation) at Atlas |
Documents & Links for Anti ARMC12 pAb (ATL-HPA075457 w/enhanced validation) | |
Datasheet | Anti ARMC12 pAb (ATL-HPA075457 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ARMC12 pAb (ATL-HPA075457 w/enhanced validation) |