Description
Product Description
Protein Description: ADP-ribosylation factor-like 9
Gene Name: ARL9
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063820: 91%, ENSRNOG00000029628: 83%
Entrez Gene ID: 132946
Uniprot ID: Q6T311
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ARL9
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063820: 91%, ENSRNOG00000029628: 83%
Entrez Gene ID: 132946
Uniprot ID: Q6T311
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KQDLEAAYHITDIHEALALSEVGNDRKMFLFGTYLTKNGSEIPSTMQDAKDLIA |
Gene Sequence | KQDLEAAYHITDIHEALALSEVGNDRKMFLFGTYLTKNGSEIPSTMQDAKDLIA |
Gene ID - Mouse | ENSMUSG00000063820 |
Gene ID - Rat | ENSRNOG00000029628 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti ARL9 pAb (ATL-HPA072942 w/enhanced validation) | |
Datasheet | Anti ARL9 pAb (ATL-HPA072942 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ARL9 pAb (ATL-HPA072942 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti ARL9 pAb (ATL-HPA072942 w/enhanced validation) | |
Datasheet | Anti ARL9 pAb (ATL-HPA072942 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ARL9 pAb (ATL-HPA072942 w/enhanced validation) |